alpha2cen

This diagram has some difference what you said. http://en.wikipedia....300_no_WMAP.jpg I do not know this diagram exactly describe Big Bang, but the diagram has difference what you said. Expansion and accelerated expansion energy term is curious. At the cooling state after inflation only kinetic energy term is active? Many discussion might be done before. But...? Are we on Big Bang state? Or How about Higgs potential decrease with time, or gravity decrease? The conclusion might be clear after many research.

on the catalyst CO + H2O --> CO2 + H2 and separate H2 from the other gas using membrane or so H2--->fuel cell and not reacted CO + O2---> CO2 reaction occurs on the oxidation catalyst. Current fuel cell is operated at the high temperature. But, high temperature resisting material and electrolyte solution are difficult parts to make.

I would like to study about searching similar species or similar DNA profile at the Blast DB. Using the bioruby program(gem program) I could do it well before. I used it several times without problem. So, they block to use the DB(bio DB) against the external user? In that case" Socket Error" message appears?

Vertical particle number density is all the same in the Universe? Vertical particle number of the beginning of the Universe = present number?

This program work well before. But it does not give query search result any more. When that kind phenomena occurs? What is the socket error? Special question?

Catalytic reaction is not simple. Even two reactant CO and H2 is supplied into the reactor, many products are produced depends on catalyst particle size, residence time, temperature and pressure. Long residence time occurs many side reaction.

I used bioruby program before. But it has some problem. What is the matter? It dose not work well. I do not know the cause of the trouble. ruby program [quit] require 'rubygems' require 'bio' #if __FILE__ == $0 begin require 'pp' alias p pp rescue LoadError end puts ">>> Bio::DDBJ::XML::Blast" serv = Bio::DDBJ::XML::Blast.new # serv.log = STDERR query = "MSSRIARALALVVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL" puts "### searchSimple('blastp', 'SWISS', query)" puts serv.searchSimple('blastp', 'SWISS', query) execution result >>> Bio::DDBJ::XML::Blast /usr/lib/ruby/1.8/net/http.rb:560:in `initialize': getaddrinfo: Name or service not known (SocketError) When the SocketError occurs?

NIH site is good for you. http://blast.ncbi.nlm.nih.gov/

If the Universe were not expansion, particles life time would not be so long. In that situation, our human being might be no existence?

Conversion and selectivity are depended on the reactant flow rate and temperature. During the operation carbon deposition is a problem. It decreases the catalyst activity.

Using methane(natural gas) is an easy way. If organic stuff to methanol converting is easy, why many bio-ethanol company make ethanol from the expensive corn?

Plank scale is constant before beginning of the Universe? Or, after inflation Plank scale is fixed?

CMBR is a microwave. So, it's figure is affected by observer's the moving speed and direction.

CMRR has a blue shift or a redshift, too. http://www.scienceforums.net/topic/67119-how-do-we-know-the-distance-from-the-supernova/page__view__findpost__p__692561

Is the vaccination a human modification? Current technology is at the level of protein modification.

That is an ideal thought. The information we could know is limited. We even do not know even old past about far away star. But, we might dimly estimate the present Universe by using Universe model and obtained data. It would be a 3d map, which contains Universe model.

Short time Doppler theory fits perfectly. But I have not found any reference about the very long time Doppler effect.

Redshift is only depend on two object's relative speed and direction. But, some doubt remain. Redshift exposure time gives no effect to redshift value? Does 10000yr redshift have no difference than 10yr redshift, if moving condition is the same?

Energy source is a problem. How about this two step? 1)Unseen particle(or energy) creation ---> 2)unseen particle( or energy) to mass(Steady State or On Big Bang) Energy creation at some place in current Universe is very epoch-making theory, it will be almost impossible. Problem of 1) step is where is the unseen particle (or energy) from.

Is the tissue size too large? Is xylene clearing time too short? Some alcohol might remain in the tissue. I think that to read the experiment section in the paper more observantly will be good to solve this problem.

How about this concept? Higgs field becomes weak. My link Particles behavior at the beginning. My link Neutron speed and decay rate http://www.scienceforums.net/topic/68318-single-neutron-decay-rate-is-constant/page__view__findpost__p__697297

Time is only one parameter in the physical world never come back. Time is a hidden parameter contained in the all variables.

Uncertainty principle is a back bone of quantum physics. At the high speed experiment, how do we know the particle position exactly?

Thank you for good calculation. Possible speed is like this. Galaxy rotation speed x 2 x100(1% speed variation)= 50000km/s Actually the speed can be used in the neutron process??

Current detection method is based on many past research. It does not come from simple idea. Many colliders were bulit and tested before constructing this collider. To say everything is wrong is not scientific method. If you find an illogical thing, you will say what is wrong in detail.