Jump to content

TeenieBopper

New Members
  • Posts

    1
  • Joined

  • Last visited

Profile Information

  • Favorite Area of Science
    Math/Statistics

TeenieBopper's Achievements

Lepton

Lepton (1/13)

0

Reputation

  1. Consider the following protein sequence. Circle the regions of the protein that you think will either be an internal part of a protein, or found as a transmembrane domain. MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK I have no idea how to do this. I did a google search, and I found something that said the internal parts of a protein are more likely to be hydrophobic. I went through and found all the hydrophobic amino acids. For the most part, it seemed like hydrophobic were distributed randomly throughout the sequence, except for one part, identified in bold below: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK Am I correct in thinking that the bolded part is the region that's part of the internal part of the protein? And that everything else is part of the transmembrane domain?
×
×
  • Create New...

Important Information

We have placed cookies on your device to help make this website better. You can adjust your cookie settings, otherwise we'll assume you're okay to continue.