Consider the following protein sequence. Circle the regions of the protein that
you think will either be an internal part of a protein, or found as a transmembrane domain.
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW
SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK
QTKRMLDMKVNPIQGLASKWDYEKNEWKK
I have no idea how to do this. I did a google search, and I found something that said the internal parts of a protein are more likely to be hydrophobic. I went through and found all the hydrophobic amino acids. For the most part, it seemed like hydrophobic were distributed randomly throughout the sequence, except for one part, identified in bold below:
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW
SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK
QTKRMLDMKVNPIQGLASKWDYEKNEWKK
Am I correct in thinking that the bolded part is the region that's part of the internal part of the protein? And that everything else is part of the transmembrane domain?
