TeenieBopper Posted March 24, 2013 Share Posted March 24, 2013 (edited) Consider the following protein sequence. Circle the regions of the protein that you think will either be an internal part of a protein, or found as a transmembrane domain. MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK I have no idea how to do this. I did a google search, and I found something that said the internal parts of a protein are more likely to be hydrophobic. I went through and found all the hydrophobic amino acids. For the most part, it seemed like hydrophobic were distributed randomly throughout the sequence, except for one part, identified in bold below: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK QTKRMLDMKVNPIQGLASKWDYEKNEWKK Am I correct in thinking that the bolded part is the region that's part of the internal part of the protein? And that everything else is part of the transmembrane domain? Edited March 24, 2013 by TeenieBopper Link to comment Share on other sites More sharing options...
Essay Posted March 24, 2013 Share Posted March 24, 2013 That sounds very reasonable to me. If it is not correct, I'd like to know why. ~ Link to comment Share on other sites More sharing options...
BabcockHall Posted April 2, 2013 Share Posted April 2, 2013 Do we know whether this protein has a single alpha helix as the transmembrane domain, or are there multiple alpha helices? A few proteins have beta transmembrane domains also, but perhaps we can ignore them. I think your answer might be backwards. Link to comment Share on other sites More sharing options...
CharonY Posted April 3, 2013 Share Posted April 3, 2013 (edited) Based on the available info the answer as well as the reasoning sound reasonable to me. Bonus if you want to do some digging: it is a cytochrome c oxidase subunit. Edit: After re-reading it appears that I may have misunderstood OP. To clarify, the hyrdrophobic run is the part that is located within the membrane. the rest would be intra- or extracellular, respectively. Edited April 10, 2013 by CharonY Link to comment Share on other sites More sharing options...
Recommended Posts
Create an account or sign in to comment
You need to be a member in order to leave a comment
Create an account
Sign up for a new account in our community. It's easy!
Register a new accountSign in
Already have an account? Sign in here.
Sign In Now