Jump to content

Recommended Posts

Posted

So I have a question about the active form of insulin. I know the 1 letter amino acid sequence for insulin is:

 

GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT

 

I used http://web.expasy.org/compute_pi/ to calculate the theoretical pI of insulin which is around 5.39. The question is what the charge of this insulin would be in a pH solution of 7.4.

 

The exact question is: At pH 7.4, what would be the charge (if any) for insulin? Explain how you came to that conclusion.

 

I know when in a pH solution that is higher than the pI value of the protein then the amino acid will be deprotinated and migrate to the positive side. So would the answer be that it is negatively charge or do I have to come up with an exact number like -2?

 

 

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!

Register a new account

Sign in

Already have an account? Sign in here.

Sign In Now
×
×
  • Create New...

Important Information

We have placed cookies on your device to help make this website better. You can adjust your cookie settings, otherwise we'll assume you're okay to continue.